Specification
Description | Recombinant protein from the full-length sequence of Homo sapiens small muscle protein X-linked (SMPX), transcript variant 1 (NM_014332). |
Organism | Homo sapiens (Human) |
Expression Host | Human Cells |
Tag Info | His or DYKDDDDK. Please contact us if you need further information or require specific designed tag. |
Purity | Greater than 90% by SDS-PAGE gel |
Uniprot ID | Q9UHP9 |
Entry Name | SMPX_HUMAN |
Gene Names | SMPX SRMX |
Alternative Gene Names | SRMX |
Alternative Protein Names | Small muscular protein (Stretch-responsive skeletal muscle protein) |
Application | Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only! |
Buffer | Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives |
Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg) |
Length | 88 |
Molecular Weight(Da) | 9559 |
Protein Sequence | (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.) MNMSKQPVSNVRAIQANINIPMGAFRPGAGQPPRRKECTPEVEEGVPPTSDEEKKPIPGAKKLPGPAVNLSEIQNIKSELKYVPKAEQ |
Background
Function | FUNCTION: Plays a role in the regulatory network through which muscle cells coordinate their structural and functional states during growth, adaptation, and repair. {ECO:0000250}. |
Pathway | |
Protein Families | SMPX family |
Tissue Specificity | Preferentially and abundantly expressed in heart and skeletal muscle. |
QC Data
Note | Please contact us for QC Data |
Product Image (Reference Only) | ![]() |